IthaID: 915



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 32 CTG>CGG [Leu>Arg] HGVS Name: HBB:c.98T>G
Hb Name: Hb Castilla Protein Info: β 32(B14) Leu>Arg

Context nucleotide sequence:
GTCTATTTTCCCACCCTTAGGCTGC [A/C/G/T] GGTGGTCTACCCTTGGACCCAGAGG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLRVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70822
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Asian Indian | Spanish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Garel MC, Blouquit Y, Rosa J, Arous N, Romero Garcia C, Hemoglobin Castilla beta 32 (B14) Leu leads to Arg; a new unstable variant producing severe hemolytic disease., FEBS Lett. , 58(1), 144-8, 1975 PubMed
  2. Thillet J, Garel MC, Bierme R, Rosa J, Oxidation properties of two hemoglobin variants with their mutation localized in the heme pocket: Hb Castilla beta 32 (B14) Leu replaced by Arg and Hb Toulouse beta 66 (E10) Lys replaced by Glu, and abnormal functional properties of Hb Castilla., Biochim. Biophys. Acta , 624(1), 293-303, 1980 PubMed
  3. Walker L, McFarlane A, Patterson M, Eng B, Waye JS, Hb Castilla [beta32(B14)Leu --> Arg] caused by a de novo mutation., Hemoglobin, 27(4), 253-6, 2003 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2016-08-24 13:28:28 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.