IthaID: 893
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 26 GAG>GGG | HGVS Name: | HBB:c.80A>G |
Hb Name: | Hb Aubenas | Protein Info: | β 26(B8) Glu>Gly |
Context nucleotide sequence:
GTGAACGTGGATGAAGTTGGTGGTG [A>G] GGCCCTGGGCAGGTTGGTATCAAGG (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGGALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Also known as:
Comments: Found in a proband of French origin and in one of her two siblings without haematological or clinical features. Parents refused testing. Blood smears showed anisocytosis. The abnormal Hb was revealed by isoelectrofocusing (IEF), cellulose acetate electrophoresis and cation exchange HPLC. Slightly unstable as detected by the isopropanol test. Normal α/β biosynthetic ratio. In contrast to HbE (HBB:c.79G>A), this base substitution does not lead to a consensus nt sequence for splicing.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | N/A |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 70674 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 1 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | N/A |
Ethnic Origin: | French, Iranian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Sequence Viewer
Publications / Origin
- Lacan P, Francina A, Promé D, Delaunay J, Galactéros F, Wajcman H, Hb Aubenas [beta 62(B8)Glu-->Gly]: a new variant normally synthesized, affecting the same codon as in Hb E., Hemoglobin, 20(2), 113-24, 1996 PubMed
- Jalilian M, Azizi Jalilian F, Ahmadi L, Amini R, Esfehani H, Sosanian M, Rabbani B, Maleki M, Mahdieh N, The Frequency of HBB Mutations Among β-Thalassemia Patients in Hamadan Province, Iran., Hemoglobin, 41(1), 61-64, 2017 PubMed
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:16 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2020-09-28 16:20:30 | The IthaGenes Curation Team | Reviewed. Comment, Allele, Reference added. |
4 | 2024-03-07 10:51:30 | The IthaGenes Curation Team | Reviewed. Chromosome location corrected. |