IthaID: 88



Names and Sequences

Functionality: Globin gene causative mutation
Common Name: CD 26 GAG>AAG [Glu>Lys] HGVS Name: HBB:c.79G>A
Hb Name: HbE Protein Info: β 26(B8) Glu>Lys

Context nucleotide sequence:
GGTGAACGTGGATGAAGTTGGTGGT [A/C/G/T] AGGCCCTGGGCAGGTTGGTATCAAG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGKALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70673
Size: 1 bp
Located at: β
Specific Location: Exon 1

Phenotype

Hemoglobinopathy Group: Thalassaemia and Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-thalassaemia, β-chain variant
Allele Phenotype:β+
Thalassaemia
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: Haemolytic anaemia [HP:0001878]
Ineffective erythropoiesis [HP:0010972]

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Cryptic splice site (mRNA Processing), Missense codons (Protein Structure)
Ethnic Origin: SE Asian, European, Far East
Inheritance: Recessive
DNA Sequence Determined: Yes
Detection Methods: Direct DNA sequencing

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
26HbEβD-10Dual Kit Program28.93.15Heterozygous[PDF]
335HbEβD-10Dual Kit Program87.32.87Homozygote.[PDF]
433HbEβD-10Dual Kit Program29.62.96heterozygote[PDF]
458HbEβD-10Dual Kit Program19.92.96HbE heterozygote with alpha-thal 1 heterozygote. [PDF]
462HbEβD-10Dual Kit Program28.82.92Association of HbE and Hb Constant Spring[PDF]
564HbEβD-10Dual Kit Program41.22.78Association of HbE and beta-thalassaemia. [PDF]
38HbEβVARIANT IIDual Kit Program27.63.65Heterozygous[PDF]
39HbEβVARIANT IIDual Kit Program22.42.969Heterozygous[PDF]
338HbEβVARIANT IIDual Kit Program69.42.9Homozygote.[PDF]
436HbEβVARIANT IIDual Kit Program25.92.926heterozygote[PDF]
461HbEβVARIANT IIDual Kit Program18.92.91HbE heterozygote with alpha-thal 1 heterozygote.[PDF]
465HbEβVARIANT IIDual Kit Program27.22.899Association of HbE and Hb Constant Spring[PDF]
567HbEβVARIANT IIDual Kit Program42.62.885Association of HbE and beta-thalassaemia. [PDF]
336HbEβVARIANTβ-thal Short Program76.43.65Homozygote.[PDF]
434HbEβVARIANTβ-thal Short Program253.63heterozygote[PDF]
459HbEβVARIANTβ-thal Short Program17.73.64HbE heterozygote with alpha-thal 1 heterozygote. [PDF]
463HbEβVARIANTβ-thal Short Program25.33.68Association of HbE and Hb Constant Spring[PDF]
565HbEβVARIANTβ-thal Short Program473.73Association of HbE and beta-thalassaemia. [PDF]
37HbEβVARIANT IIβ-thal Short Program25.13.66Heterozygous[PDF]
337HbEβVARIANT IIβ-thal Short Program69.53.64Homozygote.[PDF]
435HbEβVARIANT IIβ-thal Short Program25.13.65heterozygote[PDF]
460HbEβVARIANT IIβ-thal Short Program19.43.68HbE heterozygote with alpha-thal 1 heterozygote.[PDF]
464HbEβVARIANT IIβ-thal Short Program27.13.68Association of HbE and Hb Constant Spring[PDF]
566HbEβVARIANT IIβ-thal Short Program51.63.69Association of HbE and beta-thalassaemia. [PDF]
64HbEβVARIANT IIDual Kit Program - HbA1c85.91.737homozygote[PDF]
18HbEβD-10HbA1c Program31.41.59Heterozygous[PDF]
20HbEβD-10HbA1c Program80.81.58Homozygous[PDF]
19HbEβVARIANT IIHbA1c Program30.31.86Heterozygous[PDF]
21HbEβVARIANT IIHbA1c Program80.11.84Homozygous[PDF]

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Frequencies

Publications / Origin

  1. Flatz G, Pik C, Sringam S, Haemoglobin E and beta-thalassaemia: their distribution in Thailand., Annals of human genetics, 29(2), 151-70, 1965 PubMed
  2. Fairbanks VF, Oliveros R, Brandabur JH, Willis RR, Fiester RF, Homozygous hemoglobin E mimics beta-thalassemia minor without anemia or hemolysis: hematologic, functional, and biosynthetic studies of first North American cases., American journal of hematology, 8(1), 109-21, 1980 PubMed
  3. Orkin SH, Kazazian HH, Antonarakis SE, Ostrer H, Goff SC, Sexton JP, Abnormal RNA processing due to the exon mutation of beta E-globin gene., Nature, 300(5894), 768-9, 1982 PubMed
  4. Kazazian HH, Waber PG, Boehm CD, Lee JI, Antonarakis SE, Fairbanks VF, Hemoglobin E in Europeans: further evidence for multiple origins of the beta E-globin gene., American journal of human genetics, 36(1), 212-7, 1984 PubMed
Created on 2010-06-16 16:13:14, Last reviewed on 2014-04-23 17:23:36 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.

Please publish modules in offcanvas position.