IthaID: 806



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 5 CCT>GCT [Pro>Ala] HGVS Name: HBB:c.16C>G
Hb Name: Hb Gorwihl Protein Info: β 5(A2) Pro>Ala

Context nucleotide sequence:
AACAGACACCATGGTGCATCTGACT [C/G] CTGAGGAGAAGTCTGCCGTTACTGC (Strand: -)

Protein sequence:
MVHLTAEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as: Hb Hinchingbrooke

Comments: Hb Görwihl first described in a 74-year-old German male with an exceptionally low HbA1c value. Most recently, found in a 58-year-old Caucasian male with pathological values of OGTT but undetectable HbA1c levels. Hb Görwihl has functional properties similar to those of normal HbA and, in a heterozygous state, is not associated with clinical symptoms or haematological abnormalities. It only demonstrates altered glycation of the chains with a consequent reduction in the value of glycated haemoglobin.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70610
Size: 1 bp
Located at: β
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: German, Caucasian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Bissé E, Schauber C, Zorn N, Epting T, Eigel A, Van Dorsselaer A, Wieland H, Kister J, Kiger L, Hemoglobin Görwihl [alpha2beta(2)5(A2)Pro-->Ala], an electrophoretically silent variant with impaired glycation., Clinical chemistry, 49(1), 137-43, 2003 PubMed
  2. Ito S, Nakahari T, Yamamoto D, Relationship between impaired glycation and the N-terminal structure of the Hb Görwihl [beta5(A2)Pro-->Ala] variant., Hemoglobin , 34(2), 151-6, 2010 PubMed
  3. Salvatici M, Caslini C, Alesci S, Arosio G, Meroni G, Ceriotti F, Ammirabile M, Drago L, The Application of Clinical and Molecular Diagnostic Techniques to Identify a Rare Haemoglobin Variant., Int J Mol Sci, 25(12), , 2024 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2024-07-10 12:25:32 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.