IthaID: 694



Names and Sequences

Functionality: Globin gene causative mutation
Common Name: CD 102 AGC>AGA [Ser>Arg] HGVS Name: HBA2:c.309C>A
Hb Name: Hb Manitoba III Protein Info: α2 102(G9) Ser>Arg

Context nucleotide sequence:
CCCTCTTCTCTGCACAGCTCCTAAG [A/C/G] CACTGCCTGCTGGTGACCCTGGCCG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLRHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

External Links

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34343
Size: 1 bp
Located at: α2
Specific Location: Exon 3

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Taiwanese
Inheritance: Recessive
DNA Sequence Determined: Yes
Detection Methods: Direct DNA sequencing

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Crookston JH, Farquharson HA, Kinderlerer JL, Lehmann H HEMOGLOBIN MA, alpha 102(G9) serine replaced by arginine., Can. J. Biochem. , 48(8), 911-4, 1970 PubMed
  2. Wrightstone RN, Smith LL, Wilson JB, Vella F, Huisman TH, Some physicochemical properties of hemoglobin-manitoba (alpha2 102Ser replaced by Arg (G9) beta2)., Biochim. Biophys. Acta , 412(2), 283-7, 1975 PubMed
  3. Sciarratta GV, Ivaldi G, Molaro GL, Sansone G, Salkie ML, Wilson JB, Reese AL, Huisman TH, The characterization of hemoglobin Manitoba or alpha (2)102(G9)Ser----Arg beta 2 and hemoglobin Contaldo or alpha (2)103(G10)His----Arg beta 2 by high performance liquid chromatography., Hemoglobin , 8(2), 169-81, 1984 PubMed
  4. Molchanova TP, Pobedimskaya DD, Huisman TH, The differences in quantities of alpha 2- and alpha 1-globin gene variants in heterozygotes., Br. J. Haematol. , 88(2), 300-6, 1994 PubMed
  5. Chang JG, Shih MC, Liu SC, Chan WL, Peng CT, Hb Manitoba in a Taiwanese family: a C-->A substitution at codon 102 of the alpha2-globin gene., Hemoglobin , 25(4), 437-9, 2001 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2014-04-14 16:20:54 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.

Please publish modules in offcanvas position.