IthaID: 679



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 94 GAC>GAG [Asp>Glu] HGVS Name: HBA1:c.285C>G | HBA2:c.285C>G
Hb Name: Hb Roanne Protein Info: α2 or α1 94(G1) Asp>Glu
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TGCACGCGCACAAGCTTCGGGTGGA [C/G] CCGGTCAACTTCAAGGTGAGCGGCG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVEPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34177 or 37981
Size: 1 bp or 1 bp
Located at: α1 or α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: French
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
97Hb Roanneα1 or α2D-10Dual Kit Program871.7Heterozygote clinically normal. Elutes as HbA.[PDF]
98Hb Roanneα1 or α2VARIANTβ-thal Short Program88.52.48Heterozygote clinically normal. Elutes as HbA.[PDF]
99Hb Roanneα1 or α2VARIANT IIβ-thal Short Program89.12.43Heterozygote clinically normal. Elutes as HbA.[PDF]
100Hb Roanneα1 or α2VARIANT IIDual Kit Program87.91.76Heterozygote clinically normal. Elutes as HbA.[PDF]

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Kister J, Kiger L, Francina A, Hanny P, Szymanowicz A, Blouquit Y, Promé D, Galactéros F, Delaunay J, Wajcman H, Hemoglobin Roanne [alpha 94(G1) Asp-->Glu]: a variant of the alpha 1 beta 2 interface with an unexpected high oxygen affinity., Biochim. Biophys. Acta , 1246(1), 34-8, 1995 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2014-04-14 13:09:38 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.