IthaID: 449



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 6 GAC>GCC [Asp>Ala] HGVS Name: HBA1:c.20A>C | HBA2:c.20A>C
Hb Name: Hb Sawara Protein Info: α2 or α1 6(A4) Asp>Ala

Context nucleotide sequence:
CCCACCATGGTGCTGTCTCCTGCCG [A/C/G/T] CAAGACCAACGTCAAGGCCGCCTGG (Strand: +)

Protein sequence:
MVLSPAAKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 33795 or 37599
Size: 1 bp or 1 bp
Located at: α1 or α2
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Japanese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Sumida I, Ota Y, Imamura T, Yanase T, Hemoglobin Sawara: alpha 6(A4) aspartic acid leads to alanine., Biochim. Biophys. Acta , 322(1), 23-6, 1973 PubMed
  2. Sumida I, Studies of abnormal hemoglobins in western Japan. Frequency of visible hemoglobin variants, and chemical characterization of hemoglobin Sawara (alpha 26Alabeta2) and hemoglobin Mugino (Hb L Ferrara; alpha247Glybeta2)., Jinrui Idengaku Zasshi , 19(4), 343-63, 1975 PubMed
  3. Sasaki J, Imamura T, Sumida I, Yanase T, Ohya M, Increased oxygen affinity for hemoglobin Sawara: alphaA4(6) aspartic acid replaced by alanine., Biochim. Biophys. Acta , 495(1), 183-6, 1977 PubMed
Created on 2010-06-16 16:13:15, Last reviewed on 2014-03-12 15:58:29 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.