IthaID: 4112



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 38 ACC>GCC [Thr>Ala] HGVS Name: HBB:c.115A>G
Hb Name: Hb Oviedo Protein Info: N/A

Context nucleotide sequence:
TAGGCTGCTGGTGGTCTACCCTTGG [A>G] CCCAGAGGTTCTTTGAGTCCTTTGG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWAQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: The c.115A>G variant (CD 38 ACC>GCC) is a missense variant in the HBB gene predicted to cause substitution of threoning (ACC) to alanine (GCC) at position β 38(C4) Thr>Ala. It was first reported in a family with isolated low oxygen saturation (82-92%).

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70839
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: N/A
Molecular mechanism: N/A
Inheritance: Dominant
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Vega López L, Medina A, Gil-Peña H, Fonseca Mourelle A, Gutiérrez Martínez JR, Hemoglobin Oviedo (): A Cause of Low Oxygen Saturation., Hemoglobin, 48(3), 192-195, 2024 PubMed
Created on 2024-10-29 15:54:35, Last reviewed on 2024-10-29 15:59:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.