IthaID: 4107



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 47 GAC>AAC [Asp>Asn] HGVS Name: HBA2:c.142G>A
Hb Name: Hb Arya Protein Info: α2 47(CE5) Asp>Asn
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CACCAAGACCTACTTCCCGCACTTC [G/A] ACCTGAGCCACGGCTCTGCCCAGGT (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFNLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: Hb Arya was first described in an Iranian family in 1974. A recent report described Hb Arya in a Malaysian family. Both potentials were clinically asymptomatic. This abnormal haemoglobin has an electrophoretic mobility very close to that of Hb S, thereby mimicking an electrophoretic pattern of the Hb S carrier.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34034
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Iranian, Malay
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Rahbar S, Mahdavi N, Nowzari G, Mostafavi I, Haemoglobin Arya: alpha 2-47 (CD5), aspartic acid yields asparagine., Biochim. Biophys. Acta , 386(2), 525-9, 1975 PubMed
  2. Nahanthiran S, Nik Mustapha NH, Yasin N, Idris FB, Md Noor SB, Family study of haemoglobin Arya in a Malaysian family., Malays J Pathol, 46(2), 315-320, 2024 PubMed
Created on 2024-09-05 12:58:21, Last reviewed on 2024-09-05 13:01:20 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.