IthaID: 4105



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD112 TGT>TCT [Cys>Ser] HGVS Name: HBB:c.338G>C
Hb Name: Hb Jiangxi Protein Info: N/A

Context nucleotide sequence:
CAGCTCCTGGGCAACGTGCTGGTCT [G>C] TGTGCTGGCCCATCACTTTGGCAAA (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVSVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: The c.338G>C variant (Hb Jiangxi) is a missense mutation in the HBB gene, resulting in the substitution of cytosine (TGT) with serine (TCT) at position β112(G14). Initially reported in a heterozygous state in a 29-year-old female from China, this variant was associated with normal hematological indices (Hb 116 g/L, MCV 88.2 fL, MCH 29.7 pg, RBC 3.91E12/L) and hemoglobin fractions of HbA 95.9%, HbF 1.1%, and HbA2 3.0% as determined by capillary electrophoresis (CE). The abnormal hemoglobin variant could not be separated by CE electrophoresis (Capillarys 3 TERA) or HPLC (Bio-Rad D-100) but was detected using MALDI-TOF MS.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71912
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Xu, Anping2024-07-24First report.
Created on 2024-07-25 13:57:56, Last reviewed on 2024-07-25 14:01:03 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.