IthaID: 3993



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 90 AAG>AAT [Lys>Asn] HGVS Name: HBA1:c.273G>T
Hb Name: Hb Guigang Protein Info: N/A

Context nucleotide sequence:
CCCTGAGCGACCTGCACGCGCACAA [G>T] CTTCGGGTGGACCCGGTCAACTTCA (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHNLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

Comments: The c.273G>T (p.Lys90Asn) is a missense variant in the HBA1 gene that results in the substitution of lysine (AAG) with asparagine (AAT) at codon 90. The abnormal Hb variant can be separated and quantified by CE. It was first detected in a heterozygous state in a Chinese proband with normal hematological parameters and clinical phenotype.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37969
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Gan G, Li W, Huang J, Zheng L, Li T, Li Y, Hb Guigang [α90 (FG2)Lys→Asn; HBA1:c.273G˃T]: a Novel α-Globin Chain Variant., Clin Lab, 70(7), 0, 2024 PubMed

Microattributions

A/AContributor(s)DateComments
1Li, Youqiong2022-12-19First report.
Created on 2023-01-02 15:24:53, Last reviewed on 2024-08-02 11:32:44 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.