IthaID: 3961



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 122/123 (-CG,+GA) HGVS Name: HBA2:c.369_370delinsGA
Hb Name: Hb Nanning Protein Info: α2 122(H5) His>Gln and α2 123(H6) Ala>Thr

Context nucleotide sequence:
CCGCCGAGTTCACCCCTGCGGTGCA [CG/GA] GCCTCCCTGGACAAGTTCCTGGCTT (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVQASLDKFLASVSTVLTSKYR

Also known as:

Comments: The deletion/insertion causes the change of two amino acids in the H helix of the HBA2.The transition of histidine to glutamine at codon 122 and the transversion of alanine to threonine at codon 123, that have been reported in Hb Westmead [IthaID: 730] and Hb Santa Barnabas [IthaID: 731] respectively.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34403
Size: 2 bp
Located at: α2

Other details

Type of Mutation: Insertion & Deletion
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Chen B, Lin L, Yi S, Chen Q, Wei H, Li G, Zheng C, He S, Qiu X, A Novel Mutation of the α2-Globin Gene Causing α-Thalassemia: Hb Nanning (HBA2: c.369_370delinsGA)., Hemoglobin, 41(1), 56-58, 2017 PubMed
Created on 2022-08-17 10:20:47, Last reviewed on 2022-08-17 10:24:39 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.