IthaID: 3888



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 97/98 (+GCAC) HGVS Name: HBB:c.291_294dup
Hb Name: N/A Protein Info: N/A

Context nucleotide sequence:
GAGCTGCACTGTGACAAGCTGCAC [-/GCAC] GTGGATCCTGAGAACTTCAGGGTG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHARGS*

Also known as:

Comments: Found in a mother with a history of transfusion-dependent thalassemia and also in her child presented with anemia and clinical data of thalassemia. The 4 bp insertion (GCAC), causes a frameshift that introduces a premature stop codon four amino acids further down the new reading frame.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: β-thalassaemia
Allele Phenotype:β0
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71015
Size: 4 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Insertion)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Mexican
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Martínez Villegas O, Mendoza-Meléndez D, Trueba-Gómez R, Rosenfeld-Mann F, Baptista-González HA, Estrada-Juárez H, Analysis of a Novel Mexican Variant of the Gene Associated with β-Thalassemia Using Bioinformatic Tools., Hemoglobin, 45(2), 87-93, 2021 PubMed
Created on 2022-01-28 14:00:10, Last reviewed on 2022-08-24 09:24:44 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.