IthaID: 3870
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 62 GCT>CCT [Ala>Pro] | HGVS Name: | HBD:c.187G>C |
Hb Name: | N/A | Protein Info: | δ 62(E6) Ala>Pro |
Context nucleotide sequence:
GGGCAACCCTAAGGTGAAG [G/C] CTCATGGCAAGAAGGTGCT (Strand: -)
Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKPHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
Also known as:
Comments: Found in a 65-year-old female in a Tunisian study of δ-thalassaemia. Crystallographic structure analysis demonstrated that the Ala62Pro variant probably leads to a significant conformational change that affects the secondary structure of the delta subunit. In fact, the Ala62 is the 6th amino acid is involved in the formation of the 5th α-helix and its change to proline would destabilize the conserved structure of the 5th α-helix.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
No available links
Phenotype
Hemoglobinopathy Group: | Thalassaemia |
---|---|
Hemoglobinopathy Subgroup: | δ-thalassaemia |
Allele Phenotype: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 63497 |
Size: | 1 bp |
Located at: | δ |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Tunisian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Sequence Viewer
Publications / Origin
- Kasmi C, Amri Y, Hadj-Fredj S, Oueslati S, Dabboussi M, Mahjoub R, Hammami S, Aljane I, Mami FB, Jamoussi H, Messaoud T, Bibi A, Analysis of δ-globin gene alleles in Tunisians: description of three new delta-thalassemia mutations., Mol Biol Rep, 48(8), 5923-5933, 2021 PubMed
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2021-10-12 12:56:13 | The IthaGenes Curation Team | Created |
2 | 2021-12-29 15:21:14 | The IthaGenes Curation Team | Reviewed. Text edits. |