IthaID: 3788



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 65 GCG>CCG [Ala>Pro] HGVS Name: HBA1:c.196G>C
Hb Name: Hb Maruchi Protein Info: α1 65(E14) Ala>Pro
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CACGGCAAGAAGGTGGCCGAC [G/C] CGCTGACCAACGCCGTGGCGC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADPLTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: Found in a 37-year-old Spanish male presented with microcytosis. The new variant cannot be separated from Hb A by electrophoretic and chromatographic techniques and causes α-thalassemia silent associated with a very mild phenotype. Hb Maruchi is a new silent variant and authors believe that it is a hyperunstable protein.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia and Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-thalassaemia, α-chain variant
Allele Phenotype:α⁺
Silent Hb
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37892
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Spanish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Paloma Ropero, Jorge M Nieto, Fernando-Ataúlfo González Fernández, Ana Villegas, Celina Benavente, Hb Maruchi [α165 (E14) Ala>Pro; HBA1: c.196G>C]: A new thalassemia hemoglobinopathy related to the alpha1 globin gene, Clin Biochem, 2021 PubMed
Created on 2021-05-12 20:31:35, Last reviewed on 2021-05-14 10:04:51 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.