IthaID: 3717
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
---|---|---|---|
Common Name: | CD 61 AAG>-AG | HGVS Name: | HBA1:c.184del |
Hb Name: | N/A | Protein Info: | N/A |
Context nucleotide sequence:
TCTGCCCAGGTTAAGGGCCACGGCAAG [A/-] AGGTGGCCGACGCGCTGACCAACGCCG (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKRWPTRX
Also known as:
Comments: Found in a 34-year old pregnant Malay woman with Hb H disease, presented with Hb 10.2 g/dL, MCH 18 pg, MCV 59.7 fL and RBC 5.7 10^12/L. The woman was compound heterozygote of the novel mutation and the SEA deletion [IthaID: 309]. Hb analysis through CE shows HbA2 1.2 % and HbH 2.3 %. The T deletion, causing a frameshift that introduces a premature stop codon five amino acids further down the new reading frame.
External Links
No available links
Phenotype
Hemoglobinopathy Group: | Thalassaemia |
---|---|
Hemoglobinopathy Subgroup: | α-thalassaemia |
Allele Phenotype: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 37880 |
Size: | 1 bp |
Located at: | α1 |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Deletion) |
---|---|
Effect on Gene/Protein Function: | Frameshift (Translation) |
Ethnic Origin: | Malay |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
Sequence Viewer
Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
In such a case, please Refresh the page or retry at a later stage.
Otherwise, use this external link.
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
A/A | Contributor(s) | Date | Comments |
---|---|---|---|
1 | Mohd Yasin, Norafiza | 2020-11-24 | First report. |
Created on 2021-01-30 14:27:28,
Last reviewed on 2021-02-01 11:53:17 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2021-01-30 14:27:28 | The IthaGenes Curation Team | Created |
2 | 2021-01-30 15:04:16 | The IthaGenes Curation Team | Reviewed. Protein info corrected. |
3 | 2021-02-01 11:53:17 | The IthaGenes Curation Team | Reviewed. Protein sequence corrected. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2022-06-24 13:54:27