IthaID: 3713

Names and Sequences

Functionality:	Globin gene causative mutation	Pathogenicity:	N/A
Common Name:	CD 11 AAG>ACG [Lys>Thr]	HGVS Name:	HBA2:c.35A>C
Hb Name:	N/A	Protein Info:	N/A

Context nucleotide sequence:
TGTCTCCTGCCGACAAGACCAACGTCA [A>C] GGCCGCCTGGGGTAAGGTCGGCGCGC (Strand: +)

Protein sequence:
MVLSPADKTNVTAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

Comments: Reported in 1 case presented with Hb 14.7 g/dL and normal levels of MCV and MCH Hb analyses revealed HbA2 1.8 % and an abnormal peak of 27 %.

External Links

No available links

Phenotype

Hemoglobinopathy Group:	Structural Haemoglobinopathy
Hemoglobinopathy Subgroup:	α-chain variant
Allele Phenotype:	N/A
Stability:	N/A
Oxygen Affinity:	N/A
Associated Phenotypes:	N/A

IthaPhen

Heterozygous records (preview in IthaPhen)

Location

Chromosome:	16
Locus:	NG_000006.1
Locus Location:	33810
Size:	1 bp
Located at:	α2
Specific Location:	Exon 1

Other details

Type of Mutation:	Point-Mutation(Substitution)
Effect on Gene/Protein Function:	Missense codons (Protein Structure)
Ethnic Origin:	N/A
Molecular mechanism:	N/A
Inheritance:	Recessive
DNA Sequence Determined:	Yes

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/A	Contributor(s)	Date	Comments
1	Mohd Yasin, Norafiza	2020-11-24	First report.

Created on 2021-01-30 13:58:49, Last reviewed on 2021-02-01 11:40:11 (Show full history)

A/A	Date	Curator(s)	Comments
1	2021-01-30 13:58:49	The IthaGenes Curation Team	Created
2	2021-01-30 14:00:55	The IthaGenes Curation Team	Reviewed. Comment corrected.
3	2021-02-01 11:40:11	The IthaGenes Curation Team	Reviewed. Protein sequence added.

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.