IthaID: 3619



Names and Sequences

Functionality: Disease modifying mutation Pathogenicity: N/A
Common Name: rs1051169 HGVS Name: NC_000021.9:g.46602317C>G

Context nucleotide sequence:
CTCATTGTTGATGAGCTCCTT [C>G] AGTTCGGATTTCTTCAGCTTG (Strand: +)

Protein sequence:
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Also known as:

Comments: The 'G' allele associated with lesser pain (CPI) scores in a sickle cell disease cohort of mainly African-Americans. The variation also appeared to influence chronic pain in SCD in a sex-specific manner, reaching statistical significance in females but not males.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Allele Phenotype (Cis):Decreased expression for S100B
Allele Phenotype (Trans):N/A
Associated Phenotypes: Pain [HP:0012531]

Location

Chromosome: 21
Locus: NM_006272.3
Locus Location: N/A
Size: 1 bp
Located at: S100B
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: African-American
Molecular mechanism: N/A
Inheritance: Quantitative trait
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Jhun EH, Sadhu N, He Y, Yao Y, Wilkie DJ, Molokie RE, Wang ZJ, S100B single nucleotide polymorphisms exhibit sex-specific associations with chronic pain in sickle cell disease in a largely African-American cohort., PLoS ONE, 15(5), e0232721, 2020 PubMed
Created on 2020-09-08 10:18:23, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.