IthaID: 3608



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 50 (TCT>TGT);CD 75(ATA>ACA) HGVS Name: HBG2:c.[152C>G;227T>C]
Hb Name: Hb F-Madrid Protein Info: Gγ 50(D1) Ser>Cys;Gγ 75(E19) Ile>Thr

Protein sequence:
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSCASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH

Also known as:

Comments: The structural hemoglobin variant of Gγ with two amino acid replacements in cis found in the umbilical cord blood of a neonate in Madrid. The neonate born after a normal 40-week gestation and the main abnormal feature was a decreased MCV of 76 fl, at 1.5 years old. The neonate also carried the –α3.7 deletion.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: γ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 43161
Size: 1 bp
Located at:
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Spanish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Hojas R, Villegas A, Ropero P, Valverde F, Nogales A, González FA, José C, Villar L, García C, Two new mutations in cis on (G)gamma chain of fetal hemoglobin: Hb F-Madrid [G gamma 50(D1)Ser-->Cys] and [G gamma 75(E19)Ile-->Thr]., Ann. Hematol., 82(3), 181-3, 2003 PubMed
Created on 2020-08-07 14:14:11, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.