IthaID: 3392
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 80 AAC>AGC [Asn>Ser] | HGVS Name: | HBB:c.242A>G |
Hb Name: | Hb Moncloa | Protein Info: | β80(EF4)Asn>Ser |
Context nucleotide sequence:
AGTGATGGCCTGGCTCACCTGGACA [A/G] CCTCAAGGGCACCTTTGCCACACTG (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDSLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Also known as:
Comments: Found as a heterozygote during routine health check. Perceived to be haematologically silent. Its chromatographic profile suggests a probable interference during the monitoring of glycated haemoglobin (HbA1c).
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | Silent Hb |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 70966 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Rumanian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
Sequence Viewer
Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
In such a case, please Refresh the page or retry at a later stage.
Otherwise, use this external link.
Publications / Origin
- Torrejón MJ, Ortíz-Cabrera NV, M Nieto J, González Fernández FA, Villegas A, Martínez R, Ropero P, Hb Moncloa: A new variant of haemoglobin that interferes in the quantification of Hb A1c., Clin. Biochem., 50(9), 521-524, 2017 PubMed
Created on 2019-04-08 15:12:01,
Last reviewed on (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2019-04-08 15:12:01 | The IthaGenes Curation Team | Created |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2021-04-08 12:55:21