IthaID: 3004



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 41 TTC>GTC [Phe>Val] HGVS Name: HBB:c.124T>G
Hb Name: Hb Valme Protein Info: β 41(C7) Phe>Val

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRVFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Found as a heterozygote with normal clinical presentation. Residue 41 is involved in the binding of the bêta-globin chain with heme. In Hb Valme, although Phe > Val mutation does not change polarity because both are apolar amino acids, Phe in HbA acts as a spacer that stabilizes the heme group in the more inclined position, which it takes up in the tertiary oxy structure. Its replacement by Val makes it easier for the heme group to turn to its more upright position in the deoxy structure because Val is a smaller amino acid, lacking the phenolic ring. It changes oxygen-binding properties; nevertheless, it does not affect hemoglobin stability.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:Silent Hb
Stability: N/A
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70848
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Spanish
Molecular mechanism: Altered heme pocket
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Benítez IC, Lameiro PC, Ropero P, De la Osa JJ, Fernández FG, Ortiz AM, Hemoglobin Valme HBB:c.124T>G: a new hemoglobin variant with diminished oxygen affinity causes interference in hemoglobin A1c measurement in an automated ion-exchange HPLC method., Clin. Chem. Lab. Med. , 53(9), e211-3, 2015 PubMed
Created on 2016-08-24 10:59:40, Last reviewed on 2016-08-24 14:19:58 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.