IthaID: 2544



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 40 AGG>ACG [Arg>Thr] HGVS Name: HBB:c.122G>C
Hb Name: Hb Alcorn County Protein Info: β 40(C6) Arg>Thr
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CTGGTGGTCTACCCTTGGACCCAGA [G/C] GTTCTTTGAGTCCTTTGGGGATCTG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQTFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Comments: Reported as a heterozygous haemoglobin (Hb) variant in a 6-month-old Hispanic male and his mother. The β40 site of the mutation for Hb Alcorn County lies at the α1β2 contact region, which is involved in cooperativity and oxygen affinity, and is in the same position as that of Hb Austin and Hb Athens-GA, both of which show increased oxygen affinity. The proband's P50 was low, consistent with increased Hb oxygen affinity.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70846
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: American Indian, Irish, Hispanic
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Luu HS, McCavit TL, Park JY, Mitui M, Lopez DD, Timmons CF, Hb Alcorn County: A β-Globin Variant [β40(C6)Arg→Thr; : c.122G>C (p.Arg41Thr)] with Increased Oxygen Affinity., Hemoglobin, 43(3), 204-206, 2019 PubMed
Created on 2015-01-08 17:39:32, Last reviewed on 2020-01-10 14:35:45 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.