IthaID: 2515
Names and Sequences
Functionality: | Disease modifying mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 270 TCG>TGG | HGVS Name: | NG_013087.1:g.6783C>G |
Context nucleotide sequence:
CGCTGCCTGCCTCTTGCGCGCCCAC [C/G] AACGTCGGCCTCGCTTGGATGGCGC (Strand: +)
Protein sequence:
MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRWWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL
Also known as:
Comments: Protein change: S270W [Ser>Trp]. Found in Chinese subjects with borderline HbA2, and in Thai subjects with Hb E disorder and high levels of HbF.
External Links
Phenotype
Allele Phenotype (Cis): | N/A |
---|---|
Allele Phenotype (Trans): | Increased expression for Aγ or Gγ |
Associated Phenotypes: |
Hb F levels [HP:0011904] [OMIM:141749] Anaemia [HP:0001903] |
Location
Chromosome: | 19 |
---|---|
Locus: | NG_013087.1 |
Locus Location: | 6783 |
Size: | 1 bp |
Located at: | KLF1 |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Chinese, Thai |
Molecular mechanism: | N/A |
Inheritance: | Quantitative trait |
DNA Sequence Determined: | Yes |
Sequence Viewer
Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
In such a case, please Refresh the page or retry at a later stage.
Otherwise, use this external link.
Publications / Origin
- Lou JW, Li DZ, Zhang Y, He Y, Sun MN, Ye WL, Liu YH, Delineation of the molecular basis of borderline hemoglobin A2 in Chinese individuals., Blood Cells Mol. Dis. , 2014 PubMed
- Tepakhan W, Yamsri S, Sanchaisuriya K, Fucharoen G, Xu X, Fucharoen S, Nine known and five novel mutations in the erythroid transcription factor KLF1 gene and phenotypic expression of fetal hemoglobin in hemoglobin E disorder., Blood Cells Mol. Dis. , 59(0), 85-91, 2016 PubMed
Created on 2014-06-06 08:01:46,
Last reviewed on 2016-09-14 10:31:10 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2014-06-06 08:01:46 | The IthaGenes Curation Team | Created |
2 | 2014-06-06 08:03:03 | The IthaGenes Curation Team | Reviewed. Correction of typos. |
3 | 2014-06-06 09:04:17 | The IthaGenes Curation Team | Reviewed. Reference added. |
4 | 2014-06-06 09:04:53 | The IthaGenes Curation Team | Reviewed. |
5 | 2014-06-12 10:43:45 | The IthaGenes Curation Team | Reviewed. Common name corrected. |
6 | 2016-08-11 10:28:24 | The IthaGenes Curation Team | Reviewed. Update of mutation characterization. |
7 | 2016-08-11 10:29:41 | The IthaGenes Curation Team | Reviewed. |
8 | 2016-08-11 10:33:03 | The IthaGenes Curation Team | Reviewed. |
9 | 2016-09-14 10:29:12 | The IthaGenes Curation Team | Reviewed. Mutated sequence updated. |
10 | 2016-09-14 10:31:10 | The IthaGenes Curation Team | Reviewed. Mutation comment updated. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2022-06-24 13:54:27