IthaID: 2285



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 20 CAC>CCC [His>Pro] HGVS Name: HBA1:c.62A>C
Hb Name: Hb Fulton-Georgia Protein Info: α1 20(B1) His>Pro

Context nucleotide sequence:
GCCGCCTGGGGTAAGGTCGGCGCGC [A>C] CGCTGGCGAGTATGGTGCGGAGGCC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAPAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as: Hb Anderlecht

Comments: Initially identified by protein analysis as a His>Pro change at position α20 (α1 or α2) in a Congolese newborn and his mother and was reported as a hematologically and clinically silent variant. It was later detected by sequencing in an African-American as an α1 gene change. The α20 residue is found in the B helix, external in the Hb structure where any change in hydrophobicity leads to a large effect on the mobility. This variant is detectable by various electrophoretic methods (IEF, CAE alkaline, Citrate agar, HPLC). Molecular modelling showed that α20 His>Pro substitution did not disrupt helical structure or impact interchain interactions. The histine at α20 is likely involved in the axial intermolecular contacts of the deoxyHb S fibers, making a polar bridge with glutamic acid at β20. It is speculated that the His>Pro change could modify the rate of polymerization of deoxyHb S and the clinical severity of SCD. However, the coinheritance of this variant with heterozygous -α3.7 and Hb SC disease in the African-American proband was associated with a mild phenotype, consisting of microcytosis and anisocytosis, but no anemia or other hematological abnormality.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37641
Size: 1 bp
Located at: α1
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: African-American, Congolese
Molecular mechanism: Altered secondary structure
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Cotton F, Wajcman H, Hansen V, Lin C, Jotzo K, Haumont D, Promé D, Riou J, Miyazaki A, Galactéros F, Vertongen F, Gulbis B, Hb Anderlecht [alpha20(B1)His-->Pro]: a silent variant found in a Congolese newborn., Hemoglobin , 24(4), 299-304, 2000 PubMed
  2. Zhuang L, Patel N, Bryant S, Kutlar A, Kutlar F, Young AN, Hb Fulton-Georgia [α20(B1)His→Pro; HBA1: c.62A>C]: A New α-Globin Variant Coinherited with α-Thalassemia-2 (3.7 kb deletion) and Hb SC Disease., Hemoglobin , 37(5), 481-5, 2013 PubMed
Created on 2013-10-09 14:49:51, Last reviewed on 2023-04-28 09:45:28 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.