IthaID: 1485



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 121 GAA>AAA [Glu>Lys] HGVS Name: HBG1:c.364G>A
Hb Name: Hb F-Hull Protein Info: Aγ 121(GH4) Glu>Lys
Also known as: Hb F-Siena

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CGTTTTGGCAATCCATTTCGGCAAA [G>A] AATTCACCCCTGAGGTGCAGGCTTC (Strand: -)

Protein sequence:
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKKFTPEVQASWQKMVTAVASALSSRYH

Comments: Initially found as an electrophoretically slow component of the cord-blood haemoglobin (Hb) of three normal babies, making up 7-14% of the total Hb, and was characterized by protein analysis as a glutamic acid > lysine sustitution at position 121 in the γ-chain [PMID: 6038320]. Further characterization reported that this variant occurs in a Αγ chain [PMID: 4710228]. Molecular analysis with selected restriction endonucleases characterized Hb F-Hull as a GAA > AAA change at position Αγ121 [PMID: 2412617].

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: γ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 49177
Size: 1 bp
Located at:
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: English, Italian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Sacker LS, Beale D, Black AJ, Huntsman RG, Lehmann H, Lorkin PA, Haemoglobin F Hull (gamma-121 glutamic acid--lysine), homologous with haemoglobins O Arab and O Indonesia., British medical journal, 3(5564), 531-3, 1967 PubMed
  2. Ahern EJ, Ahern V, Wiltshire BG, Lehmann H, Further characterization of haemoglobin F Hull 121 glutamic acid leads to lysine; 136 alanine., Biochim Biophys Acta, 303(2), 242-5, 1973 PubMed
  3. Carè A, Marinucci M, Massa A, Maffi D, Sposi NM, Improta T, Tentori L, Hb F-Siena (alpha 2 a gamma t2 121 (GH4) Glu leads to Lys). A new fetal hemoglobin variant., Hemoglobin, 7(1), 79-83, 1983 PubMed
  4. Nakatsuji T, Burnley MS, Huisman TH, Fetal hemoglobin variants identified in adults through restriction endonuclease gene mapping methodology., Blood, 66(4), 803-7, 1985 PubMed
Created on 2010-06-16 16:13:17, Last reviewed on 2023-04-28 14:31:35 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.