IthaID: 1310



Names and Sequences

Functionality: Globin gene causative mutation
Common Name: CD 145 TAT>TGT HGVS Name: HBB:c.437A>G
Hb Name: Hb Rainier Protein Info: β 145(HC2) Tyr>Cys

Context nucleotide sequence:
GTGGCTAATGCCCTGGCCCACAAGT [A/G] TCACTAAGCTCGCTTTCTTGCTGTC (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKCH

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 72011
Size: 1 bp
Located at: β
Specific Location: Exon 3

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Caucasian | French | Greek | Italian
Inheritance: Recessive
DNA Sequence Determined: No
Detection Methods: Direct DNA sequencing

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
81Hb RainierβD-10Dual Kit Program73.21.69Increased oxygen affinity leading to erythrocytosis. Elutes as a shoulder in the descending part of HbA. [PDF]
84Hb RainierβVARIANT IIDual Kit Program72.21.77Increased oxygen affinity leading to erythrocytosis. Elutes as HbA.[PDF]
82Hb RainierβVARIANT IIβ-thal Short Program78.12.48Increased oxygen affinity leading to erythrocytosis. Elutes as HbA.[PDF]
83Hb RainierβVARIANT IIβ-thal Short Program78.32.51Increased oxygen affinity leading to erythrocytosis. Elutes as a shoulder in the descending part of HbA[PDF]

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Adamson JW, Parer JT, Stamatoyannopoulos G, Erythrocytosis associated with hemoglobin Rainier: oxygen equilibria and marrow regulation., The Journal of clinical investigation, 48(8), 1376-86, 1969 PubMed
Created on 2010-06-16 16:13:17, Last reviewed on 2013-10-15 17:00:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.

Please publish modules in offcanvas position.