IthaID: 1277



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 139 AAT>TAT HGVS Name: HBB:c.418A>T
Hb Name: Hb Aurora Protein Info: β 139(H17) Asn>Tyr

Context nucleotide sequence:
TCAGAAAGTGGTGGCTGGTGTGGCT [A>T] ATGCCCTGGCCCACAAGTATCACTA (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAYALAHKYH

Also known as:

Comments: Reported as a high oxygen affinity Hb variant in an individual of Dutch descent with a rich medical history. Residue β139 is not involved in the α1β2 or α1β1 interfaces, but is close to the carboxy terminal end of the β chain located in the central cavity of the Hb molecule near the 2,3-DPG binding site. The Asn at β139 interacts with β82 Lys, which is a 2,3-DPG binding site. The substitution of different amino acids at β139 may alter the 2,3-DPG binding capabilities of Hb and in turn alter its oxygen affinity.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71992
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Dutch
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Lafferty J, Ali M, Matthew K, Eng B, Patterson M, Waye JS, Identification of a new high oxygen affinity hemoglobin variant: Hb Aurora [beta 139(H17) Asn-->Tyr], Hemoglobin, 19(6), 335-41, 1995 PubMed
Created on 2010-06-16 16:13:17, Last reviewed on 2024-02-22 15:46:35 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.