IthaID: 1257



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 132 AAA>CAA [Lys>Gln] HGVS Name: HBB:c.397A>C
Hb Name: Hb K Woolwich Protein Info: β 132(H10) Lys>Gln
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CCCACCAGTGCAGGCTGCCTATCAG [A/C/G/T] AAGTGGTGGCTGGTGTGGCTAATGC (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQQVVAGVANALAHKYH

Phenotype

Hemoglobinopathy Group: Thalassaemia and Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-thalassaemia, β-chain variant
Allele Phenotype:Dominant
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: Haemolytic anaemia [HP:0001878]
Ineffective erythropoiesis [HP:0010972]

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71971
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: African
Molecular mechanism: N/A
Inheritance: Dominant
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
141 Hb K Woolwich β D-10 Dual Kit Program 33.5 0.65
142 Hb K Woolwich β VARIANT β-thal Short Program 35.2 1.29 Clinically and hematologically normal. [PDF]
143 Hb K Woolwich β VARIANT II β-thal Short Program 34.4 1.29 Clinically and hematologically normal. [PDF]
144 Hb K Woolwich β VARIANT II Dual Kit Program 37.2 0.859 Clinically and hematologically normal. [PDF]

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Ringelhann B, Konotey-Ahulu FI, Talapatra NC, Nkrumah FK, Wiltshire BG, Lehmann H, Haemoglobin K Woolwich (alpha 2, beta 2 132 lysine leads to glutamine) in Ghana., Acta haematologica, 45(4), 250-8, 1971 PubMed
  2. Cabannes R, Amegnizin P, Sangare A, Arne D, Casey R, Lehmann H, Haemoglobin K Woolwich: a study of the family of a homozygote., J. Med. Genet. , 17(3), 183-6, 1980 PubMed
Created on 2010-06-16 16:13:17, Last reviewed on 2014-05-09 09:17:17 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.