IthaID: 1243
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 128 GCT>GAT [Ala>Asp] | HGVS Name: | HBB:c.386C>A |
Hb Name: | Hb J-Guantanamo | Protein Info: | β 128(H6) Ala>Asp |
Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
AAAGAATTCACCCCACCAGTGCAGG [A/C/T] TGCCTATCAGAAAGTGGTGGCTGGT (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQDAYQKVVAGVANALAHKYH
Comments: Asp is a negatively charged group in a site normally occupied by a hydrophobic residue. As a result, the presence of Asp at the position β128 (H6) weakens the α1β1 contact between Leu residue 34 and Gly residue 35 of the α-chain. Alteration of the α1β1 interface inhibits dimer formation with subsequent accumulation of free globin subunits. Hb J-Guantanamo is slightly unstable with a high number of target cells in the peripheral blood and reduced osmotic fragility.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | N/A |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | Haemolytic anaemia [HP:0001878] |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 71960 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 3 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Benin, Chilean, Chinese, Cuban, Japanese |
Molecular mechanism: | Altered α1β1 interface |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Sequence Viewer
Publications / Origin
- Martínez G, Lima F, Colombo B, Haemoglobin J Guantanamo (alpha 2 beta 2 128 (H6) Ala replaced by Asp). A new fast unstable haemoglobin found in a Cuban family., Biochimica et biophysica acta, 491(1), 1-6, 1977 PubMed
- Thom CS, Dickson CF, Gell DA, Weiss MJ, Hemoglobin variants: biochemical properties and clinical correlates., Cold Spring Harb Perspect Med, 3(3), a011858, 2013 PubMed