IthaID: 1153



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 102 AAC>ACC [Asn>Thr] HGVS Name: HBB:c.308A>C
Hb Name: Hb Kansas Protein Info: β 102(G4) Asn>Thr
Also known as: Hb Reissmann

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GACAAGCTGCACGTGGATCCTGAGA [A/C/G] CTTCAGGGTGAGTCTATGGGACGCT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPETFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71032
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Japanese
Molecular mechanism: Altered α1β1 interface
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. REISSMANN KR, RUTH WE, NOMURA T, A human hemoglobin with lowered oxygen affinity and impaired heme-heme interactions., J. Clin. Invest. , 40(0), 1826-33, 1961 PubMed
  2. Bonaventura J, Riggs A, Hemoglobin Kansas, a human hemoglobin with a neutral amino acid substitution and an abnormal oxygen equilibrium., J. Biol. Chem. , 243(5), 980-91, 1968 PubMed
  3. Bunn HF, Subunit dissociation of certain abnormal human hemoglobins., J. Clin. Invest. , 48(1), 126-38, 1969 PubMed
  4. Gibson QH, Riggs A, Imamura T, Kinetic and equilibrium properties of hemoglobin Kansas., J. Biol. Chem. , 248(17), 5976-86, 1973 PubMed
  5. Ishiguro K, Ohba Y, Hattori Y, Miyaji T, Oshida Y, Tachinami T, Takabatake S, Nakaizumi K, Hemoglobin Kansas in a Japanese family., Hemoglobin, 7(6), 573-9, 1983 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2014-05-23 11:45:56 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.