IthaID: 1131



Names and Sequences

Functionality: Globin gene causative mutation
Common Name: CD 98 GTG>ATG [Val>Met] HGVS Name: HBB:c.295G>A
Hb Name: Hb Köln Protein Info: β 98(FG5) Val>Met

Context nucleotide sequence:
TGAGCTGCACTGTGACAAGCTGCAC [A/G/T] TGGATCCTGAGAACTTCAGGGTGAG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHMDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as: Hb San Francisco (Pacific) , Hb Ube-1

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71019
Size: 1 bp
Located at: β
Specific Location: Exon 2

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: Haemolytic anaemia [HP:0001878]

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Worldwide
Inheritance: Recessive
DNA Sequence Determined: Yes
Detection Methods: Direct DNA sequencing

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Pribilla W, Klesse P, Betke K, Lehmann H, Beale D, [Hemoglobin Köln disease: familial hypochromic hemolytic anemia with hemoglobin anomaly], Klinische Wochenschrift, 43(19), 1049-53, 1965 PubMed
  2. Carrell RW, Lehmann H, Hutchison HE, Haemoglobin Köln (beta-98 valine--methionine): an unstable protein causing inclusion-body anaemia., Nature , 210(5039), 915-6, 1966 PubMed
  3. Ohba Y, Unstable hemoglobins., Hemoglobin , 14(4), 353-88, 1990 PubMed
  4. Phyliky RL, Fairbanks VF, Thromboembolic complication of splenectomy in unstable hemoglobin disorders: Hb Olmsted, Hb Koln., Am. J. Hematol. , 55(1), 53, 1997 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2014-04-24 16:58:25 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.

Please publish modules in offcanvas position.