IthaID: 1094
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
---|---|---|---|
Common Name: | CD 89 AGT>AGR [Ser>Arg] | HGVS Name: | HBB:c.270T>R |
Hb Name: | Hb Vanderbilt | Protein Info: | β 89(F5) Ser>Arg |
Context nucleotide sequence:
AAGGGCACCTTTGCCACACTGAG [T>R] GAGCTGCACTGTGACAAGCTGCA (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLRELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Also known as:
Comments: Hb Vanderbilt ([β89(F5)Ser>Arg) has a high oxygen affinity and is observed together with polycythaemia in heterozygous individuals. It was initially detected by peptide mapping and sequence analysis, but was later reported by direct sequencing to be the result of two possible substitutions leading to the same amino acid change (AGT>AGG or AGT>AGA). The abnormal Hb can not be detected by conventional electrophoresis, but is separated from Hb A using anion exchange chromatography. It has reduced sensitivity to 2,3-diphosphoglycerate acid (2,3-DPG), possibly due to conformational change in its binding site, thereby increasing Hb affinity for oxygen.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | Increased Oxygen Affinity |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 70994 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Caucasian, Polish |
Molecular mechanism: | N/A |
Inheritance: | Dominant |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Sequence Viewer
Publications / Origin
- Paniker NV, Lin KT, Krantz SB, Flexner JM, Wasserman BK, Puett D, Haemoglobin Vanderbilt (alpha2beta289Ser leads to Arg): a new haemoglobin with high oxygen affinity and compensatory erythrocytosis., British journal of haematology, 39(2), 249-58, 1978 PubMed
- Goodyer MJ, Elhassadi EI, Percy MJ, McMullin MF, A novel base change leading to Hb Vanderbilt [β89(F5)Ser→Arg, AGT>AGA]., Hemoglobin , 35(4), 428-9, 2011 PubMed
- Shomali W, Brar R, Arekapudi SR, Gotlib JR, A Kindred with a β-Globin Base Substitution [β89(F5)Ser→Arg (AG>AG); : c.270T>G] Resulting in Hemoglobin Vanderbilt., Hemoglobin, 43(0), 273-276, 2019 PubMed
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:16 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2014-06-02 09:36:42 | The IthaGenes Curation Team | Reviewed. |
4 | 2020-01-31 12:39:45 | The IthaGenes Curation Team | Reviewed. Common and HGVS names updated. Comment and Reference added. |
5 | 2021-07-13 09:17:32 | The IthaGenes Curation Team | Reviewed. Common and HGVS name corrected. Origin added. |
6 | 2023-06-12 12:09:00 | The IthaGenes Curation Team | Reviewed. Common name and mode of inheritance corrected. Comment added. |