IthaID: 1018



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 66 AAA>GAA HGVS Name: HBB:c.199A>G
Hb Name: Hb I-Toulouse Protein Info: β 66(E10) Lys>Glu

Context nucleotide sequence:
CCCTAAGGTGAAGGCTCATGGCAAG [A/G] AAGTGCTCGGTGCCTTTAGTGATGG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKEVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:Methemoglobinaemia
Stability: Unstable
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70923
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: French, Nicaraguan
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Rosa J, Labie D, Wajcman H, Boigne JM, Cabannes R, Bierme R, Ruffie J, Haemoglobin I toulouse: beta-66 (E 10) lys glu: a new abnormal haemoglobin with a mutation localized on the E 10 porphyrin surrounding zone., Nature, 223(5202), 190-1, 1969 PubMed
  2. Labie D, Rosa J, Belkhodja O, Bierme R, Hemoglobin toulouse alpha 2 beta 2 66 (E 10) LysGlu. Structure and consequences in molecular pathology., Biochim. Biophys. Acta , 236(1), 201-7, 1971 PubMed
  3. Hendy JG, Cauchi MN, Hb I-Toulouse [beta 66(E10)Lys->Glu] in association with alpha-thalassemia., Hemoglobin , 18(3), 227-9, 1994 PubMed
  4. Xu Z, Masters IB, Barbaro P, Miller S, Kapur N, Hemoglobin I-Toulouse: A rare hemoglobinopathy presenting with low oxygen saturations., Clin Case Rep, 10(7), e6111, 2022 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2022-08-24 14:07:40 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.