IthaID: 1011



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 63 CAT>CGT [His>Arg] HGVS Name: HBB:c.191A>G
Hb Name: Hb Zürich Protein Info: β 63(E7) His>Arg
Also known as: Hb Zurich

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
ATGGGCAACCCTAAGGTGAAGGCTC [A/C/G] TGGCAAGAAAGTGCTCGGTGCCTTT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKARGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Comments: Detected in a compound heterozygous state with a clinical phenotype resembling that of beta thalassaemia intermedia. Carriers have a mild course of disease, presenting with acute haemolysis after exposure to an oxidant agent. Unstable variant due to replacement of the distal histidine of the beta-chain by an arginine residue.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70915
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: American, Japanese, Swiss, Chinese
Molecular mechanism: Altered heme pocket
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Murata K, Yamamoto S, Hirano Y, Omine M, Tsuchiya J, Ohba Y, Miyaji T, First Japanese family with the unstable hemoglobin Zürich [beta 63(e7) His leads to Arg], Japanese journal of medicine, 21(1), 40-5, 1982 PubMed
  2. Yan CLS, Chan NCN, Lam GKS, Ng KY, Cheng CK, Li CK, A new form of thalassemia intermedia: Compound heterozygous beta thalassemia and hemoglobin Zurich., Pediatr Blood Cancer, 66(6), e27720, 2019 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2019-07-29 14:50:23 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.