IthaID: 1009
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
---|---|---|---|
Common Name: | CD 63 CAT>TAT | HGVS Name: | HBB:c.190C>T |
Hb Name: | Hb M-Saskatoon | Protein Info: | β 63(E7) His>Tyr |
Context nucleotide sequence:
TATGGGCAACCCTAAGGTGAAGGCT [A/C/T] ATGGCAAGAAAGTGCTCGGTGCCTT (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAYGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Also known as: Hb Hörlein-Weber, Hb Leipzig, Hb M-Arhus, Hb M-Chicago, Hb M-Emory, Hb M-Erlangen, Hb M-Hamburg, Hb M-Hida, Hb M-Kurume, Hb M-Radom, Hb Novi Sad
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | Methemoglobinaemia |
Stability: | Unstable |
Oxygen Affinity: | Increased Oxygen Affinity |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 70914 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Worldwide |
Molecular mechanism: | Altered heme pocket |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
---|---|---|---|---|---|---|---|---|---|
77 | Hb M-Saskatoon | β | D-10 | Dual Kit Program | 6.9 | 4.7 | Methemoglobinemia and unstable variant. | [PDF] | |
78 | Hb M-Saskatoon | β | VARIANT | β-thal Short Program | 9.3 | 4.91 | Methemoglobinemia and unstable variant. | [PDF] | |
79 | Hb M-Saskatoon | β | VARIANT II | β-thal Short Program | 11.7 | 5 | Methemoglobinemia and unstable variant. | [PDF] | |
80 | Hb M-Saskatoon | β | VARIANT II | Dual Kit Program | 4.4 | 4.51 | Methemoglobinemia and unstable variant. | [PDF] |
Sequence Viewer
Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
In such a case, please Refresh the page or retry at a later stage.
Otherwise, use this external link.
Publications / Origin
- GERALD PS, EFRON ML, Chemical studies of several varieties of Hb M., Proc. Natl. Acad. Sci. U.S.A. , 47(0), 1758-67, 1961 PubMed
- JOSEPHSON AM, WEINSTEIN HG, YAKULIS VJ, SINGER L, HELLER P, A new variant of hemoglobin M disease: hemoglobin M-Chicago., J. Lab. Clin. Med. , 59(0), 918-25, 1962 PubMed
- HOBOLTH N, HEMOGLOBIN MARHUS. I. CLINICAL FAMILY STUDY., Acta Paediatr Scand , 54(0), 355-62, 1965 PubMed
- Betke K, Kleihauer E, Gehring-Müller R, Braunitzer G, Jacobi J, Schmidt I, [HbM Hamburg, a beta chain anomaly: alpha-2-beta-2-63Tyr (equals HbM Saskatoon)]., Klin. Wochenschr. , 44(16), 961-6, 1966 PubMed
- Kedar PS, Nadkarni AH, Phanasgoankar S, Madkaikar M, Ghosh K, Gorakshakar AC, Colah RB, Mohanty D, Congenital methemoglobinemia caused by Hb-MRatnagiri (beta-63CAT-->TAT, His-->Tyr) in an Indian family., American journal of hematology, 79(2), 168-70, 2005 PubMed
Created on 2010-06-16 16:13:16,
Last reviewed on 2017-04-10 12:45:53 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:16 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2015-12-03 14:26:35 | The IthaGenes Curation Team | Reviewed. Phenotype updated |
4 | 2017-04-10 12:45:53 | The IthaGenes Curation Team | Reviewed. Referenced added. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2021-02-26 08:21:52