IthaID: 485
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
|---|---|---|---|
| Common Name: | CD 23 GAG>AAG [Glu>Lys] | HGVS Name: | HBA2:c.70G>A |
| Hb Name: | Hb Chad | Protein Info: | α2 23(B4) Glu>Lys |
| Also known as: | Hb E-Keelung |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
GGGTAAGGTCGGCGCGCACGCTGGC [G/A] AGTATGGTGCGGAGGCCCTGGAGAG (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGKYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Comments: Hb Chad presented increased oxygen affinity 20% in a Japanese male [PMID:6689417]. The missense mutation GAG>AAG [Glu>Lys] at codon 23, also found in the context of a −α3.7 thalassaemia chromosome [IthaID:3915]. A recent report [PMID:35059272] reveals that the G>A substitution is located on codon 23 of the ΗΒΑ2.
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 33845 |
| Size: | 1 bp |
| Located at: | α2 |
| Specific Location: | Exon 1 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | African, Chinese, Japanese |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
| ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
|---|---|---|---|---|---|---|---|---|---|
| 93 | Hb Chad | α2 | D-10 | Dual Kit Program | 22.5 | 4.49 | Heterozygous. Clinically normal. | [PDF] | |
| 94 | Hb Chad | α2 | VARIANT | β-thal Short Program | 25.2 | 4.89 | Heterozygous. Clinically normal. | [PDF] | |
| 95 | Hb Chad | α2 | VARIANT II | β-thal Short Program | 23.6 | 4.96 | Heterozygous. Clinically normal. | [PDF] | |
| 96 | Hb Chad | α2 | VARIANT II | Dual Kit Program | 20.6 | 4.115 | Heterozygous. Clinically normal. | [PDF] |
In silico pathogenicity prediction
Sequence Viewer
Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
In such a case, please Refresh the page or retry at a later stage.
Otherwise, use this external link.
Publications / Origin
- Boyer SH, Crosby EF, Fuller GF, Ulenurm L, Buck AA, A survey of hemoglobins in the Republic of Chad and characterization of hemoglobin Chad:alpha-2-23Glu--Lys-beta-2., Am. J. Hum. Genet. , 20(6), 570-8, 1968 PubMed
- Blackwell RQ, Weng MI, Huang JT, Haemoglobin Chad, alpha23 GLU leads to LYS, in a Chinese family in Taiwan., Trop Geogr Med , 25(4), 393-6, 1973 PubMed
- Harano T, Harano K, Shibata S, Ueda S, Mori H, Imai K, Yoshida T, Hemoglobin Chad [alpha 23 (B4) Glu replaced by Lys] discovered in a Japanese with questionable polycythemia., Hemoglobin, 7(6), 581-4, 1983 PubMed
- Yoshino K, Hirota Y, Ogawa W, Sugawara K, Kawaguchi A, Yoshino H, Ishibashi M, Yoshino G, Koga M, A case of α-chain variant hemoglobin (Hb Chad) with falsely high HbA1c levels measured by immunoassay., Diabetol Int, 13(1), 330-335, 2022 PubMed
Created on 2010-06-16 16:13:15,
Last reviewed on 2022-04-08 10:49:52 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.