IthaID: 91
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
---|---|---|---|
Common Name: | CD 27 GCC>TCC [Ala>Ser] | HGVS Name: | HBB:c.82G>T |
Hb Name: | Hb Knossos | Protein Info: | β 27(B9) Ala>Ser |
Context nucleotide sequence:
GAACGTGGATGAAGTTGGTGGTGAG [G>T] CCCTGGGCAGGTTGGTATCAAGGTT (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGESLGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Also known as:
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
Hemoglobinopathy Group: | Thalassaemia and Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-thalassaemia, β-chain variant |
Allele Phenotype: | β+ Thalassaemia |
Stability: | N/A |
Oxygen Affinity: | Decreased Oxygen Affinity |
Associated Phenotypes: |
Haemolytic anaemia [HP:0001878] Ineffective erythropoiesis [HP:0010972] |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 70676 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 1 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Cryptic splice site (mRNA Processing), Missense codons (Protein Structure) |
Ethnic Origin: | Mediterranean, Algerian, Egyptian, Jordan, Tunisian, Iranian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Note:
The impact thresholds provided in this section are based on the analyses performed in Tamana et.al. For any given tool, the impact thresholds defined for the set of variants with the same effect on function as the variant examined, are preferred over those defined for the full dataset.
Frequencies
Publications / Origin
- Arous N, Galacteros F, Fessas P, Loukopoulos D, Blouquit Y, Komis G, Sellaye M, Boussiou M, Rosa J, Structural study of hemoglobin Knossos, beta 27 (B9) Ala leads to Ser. A new abnormal hemoglobin present as a silent beta-thalassemia., FEBS letters, 147(2), 247-50, 1982
- Fessas P, Loukopoulos D, Loutradi-Anagnostou A, Komis G, 'Silent' beta-thalassaemia caused by a 'silent' beta-chain mutant: the pathogenesis of a syndrome of thalassaemia intermedia., British journal of haematology, 51(4), 577-83, 1982
- Orkin SH, Antonarakis SE, Loukopoulos D, Abnormal processing of beta Knossos RNA., Blood, 64(1), 311-3, 1984
- Baklouti F, Dorléac E, Morlé L, Laselve P, Peyramond D, Aubry M, Godet J, Delaunay J, Homozygous hemoglobin Knossos (alpha 2 beta 227(B9) Ala----Ser): a new variety of beta (+)-thalassemia intermedia associated with delta (0)-thalassemia., Blood, 67(4), 957-61, 1986
- Olds RJ, Sura T, Jackson B, Wonke B, Hoffbrand AV, Thein SL, A novel delta 0 mutation in cis with Hb Knossos: a study of different genetic interactions in three Egyptian families., British journal of haematology, 78(3), 430-6, 1991
Created on 2010-06-16 16:13:14,
Last reviewed on 2024-03-07 10:55:10 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:14 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2014-04-23 12:27:17 | The IthaGenes Curation Team | Reviewed. Added ClinVar link. |
4 | 2020-07-21 12:51:08 | The IthaGenes Curation Team | Reviewed. Ethnic group and reference added. |
5 | 2023-01-10 10:00:33 | The IthaGenes Curation Team | Reviewed. Context sequence edits |
6 | 2024-03-07 10:55:10 | The IthaGenes Curation Team | Reviewed. Chromosome location corrected. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2024-04-18 10:10:45