
IthaID: 851
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 15 TGG>GGG | HGVS Name: | HBB:c.46T>G |
Hb Name: | Hb Randwick | Protein Info: | β 15(A12) Trp>Gly |
Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
GGAGAAGTCTGCCGTTACTGCCCTG [A/C/G/T] GGGGCAAGGTGAACGTGGATGAAGT (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALGGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | N/A |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 70640 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 1 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | N/A |
Ethnic Origin: | Italian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | No |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
---|---|---|---|---|---|---|---|---|---|
493 | Hb Randwick | β | D-10 | Dual Kit Program | 52.4 | 1.82 | Double heterozygote for Hb Randwick and beta-thalassaemia. | [PDF] | |
452 | Hb Randwick | β | D-10 | Dual Kit Program | 81.4 | 1.69 | Elutes with HbA. Mildly unstable. | [PDF] | |
494 | Hb Randwick | β | VARIANT | β-thal Short Program | 67.7 | 2.64 | Double heterozygote for Hb Randwick and beta-thalassaemia. | [PDF] | |
453 | Hb Randwick | β | VARIANT | β-thal Short Program | 82.6 | 2.38 | Elutes with HbA. Mildly unstable. | [PDF] | |
495 | Hb Randwick | β | VARIANT II | β-thal Short Program | 66.8 | 2.66 | Double heterozygote for Hb Randwick and beta-thalassaemia. | [PDF] | |
455 | Hb Randwick | β | VARIANT II | Dual Kit Program | 2.9 | 2.995 | Elutes with HbA2. Mildly unstable. | [PDF] | |
454 | Hb Randwick | β | VARIANT II | β-thal Short Program | 81.8 | 2.41 | Elutes with HbA. Mildly unstable. | [PDF] | |
235 | Hb Randwick | β | VARIANT II | Dual Kit Program | 61.2 | 2.98 | Double heterozygote (Hb Randwick with Beta thalassemia). It elutes in the position of HbA0 in all the systems except in the VARIANT II Dual Beta Thal program where it co-elutes with HbA2. Its association with a beta thal is extremely rare and explains both the anaemia and an increased HbF and HbA2 and if it is a beta 0 thal all the fraction eluting at the position of HbA0 is the variant. | [PDF] |
In silico pathogenicity prediction
Publications / Origin
- Gilbert AT, Fleming PJ, Sumner DR, Hughes WG, Ip F, Kwan YL, Holland RA, Hemoglobin Randwick or beta 15 (A12)Trp----Gly: a new unstable beta-chain hemoglobin variant., Hemoglobin, 12(2), 149-61, 1988
Created on 2010-06-16 16:13:16,
Last reviewed on 2013-10-15 17:00:14 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.