IthaID: 79


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 19 AAC>AGC [Asn>Ser] HGVS Name: HBB:c.59A>G
Hb Name: Hb Malay Protein Info: β 19(B1) Asn>Ser

Context nucleotide sequence:
GTTACTGCCCTGTGGGGCAAGGTGA [A>G] CGTGGATGAAGTTGGTGGTGAGGCC (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVSVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: The c.59A>G variant [β 19(B1) Asn>Ser] is a missense variant in the HBB gene that results in a mild β+ allele phenotype. Both homozygotes and compound heterozygotes with Hb E [ithaID: 88] exhibit mild disease, characterized by severe hypochromic microcytic anaemia, but they do not require blood transfusions. The CD19 AAG>ACG change contributed to thalassaemia by activating a cryptic splice site in this region of the HBB gene.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Thalassaemia and Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-thalassaemia, β-chain variant
Allele Phenotype:β++
Thalassaemia
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70653
Size: 1 bp
Located at: β
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Cryptic splice site (mRNA Processing)
Ethnic Origin: SE Asian, Chinese , Malaysian , Singapore, Thai
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Frequencies

Publications / Origin

  1. Yang KG, Kutlar F, George E, Wilson JB, Kutlar A, Stoming TA, Gonzalez-Redondo JM, Huisman TH, Molecular characterization of beta-globin gene mutations in Malay patients with Hb E-beta-thalassaemia and thalassaemia major., British journal of haematology, 72(1), 73-80, 1989
  2. Thein SL, Winichagoon P, Hesketh C, Best S, Fucharoen S, Wasi P, Weatherall DJ, The molecular basis of beta-thalassemia in Thailand: application to prenatal diagnosis., American journal of human genetics, 47(3), 369-75, 1990
Created on 2010-06-16 16:13:14, Last reviewed on 2024-08-06 12:09:21 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.