IthaID: 783


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 141 CGT>CAT [Arg>His] HGVS Name: NM_000558.3(HBA1):c.425G>A
Hb Name: Hb Suresnes Protein Info: α1 141(HC3) Arg>His

Context nucleotide sequence:
AGCACCGTGCTGACCTCCAAATACC [G/A] TTAAGCTGGAGCCTCGGTGGCCATG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 38270
Size: 1 bp
Located at: α1
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: African, French
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Poyart C, Krishnamoorthy R, Bursaux E, Gacon G, Labie D, Structural and functional studies of haemoglobin Suresnes or alpha2 141 (HC3) Arg replaced by His beta2, a new high oxygen affinity mutant., FEBS Lett. , 69(1), 103-7, 1976
  2. Gravely ME, Harris HF, Stallings M, Lam H, Wilson JB, Huisman TH, Hb Suresnes or alpha2 141(HC3) ArgyieldHis beta2 in a black family., Hemoglobin , 2(2), 187-9, 1978
  3. Poyart C, Bursaux E, Arnone A, Bonaventura J, Bonaventura C, Structural and functional studies of hemoglobin Suresnes (arg 141 alpha 2 replaced by His beta 2). Consequences of disrupting an oxygen-linked anion-binding site., J. Biol. Chem. , 255(19), 9465-73, 1980
Created on 2010-06-16 16:13:16, Last reviewed on 2024-04-12 11:51:06 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.