IthaID: 768

Names and Sequences

Functionality:	Globin gene causative mutation	Pathogenicity:	N/A
Common Name:	CD 138 TCC>CCC [Ser>Pro]	HGVS Name:	HBA1:c.415T>C \| HBA2:c.415T>C
Hb Name:	Hb Attleboro	Protein Info:	α2 or α1 138(H21) Ser>Pro

Context nucleotide sequence:
GGCTTCTGTGAGCACCGTGCTGACC [C/T] CCAAATACCGTTAAGCTGGAGCCTC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTPKYR

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

HbVar	ClinVar
dbSNP	dbSNP
OMIM	SwissVar

Phenotype

Hemoglobinopathy Group:	Structural Haemoglobinopathy
Hemoglobinopathy Subgroup:	α-chain variant
Allele Phenotype:	N/A
Stability:	N/A
Oxygen Affinity:	Increased Oxygen Affinity
Associated Phenotypes:	Haemolytic anaemia [HP:0001878]

IthaPhen

Heterozygous records (preview in IthaPhen)

Location

Chromosome:	16
Locus:	NG_000006.1
Locus Location:	34449 or 38260
Size:	1 bp or 1 bp
Located at:	α1 or α2
Specific Location:	Exon 3

Other details

Type of Mutation:	Point-Mutation(Substitution)
Effect on Gene/Protein Function:	Missense codons (Protein Structure)
Ethnic Origin:	N/A
Molecular mechanism:	Altered secondary structure
Inheritance:	Recessive
DNA Sequence Determined:	No

In silico pathogenicity prediction

Publications / Origin

McDonald MJ, Michalski LA, Turci SM, Guillette RA, Jue DL, Johnson MH, Moo-Penn WF, Structural, functional, and subunit assembly properties of hemoglobin Attleboro [alpha 138 (H21) Ser----Pro], a variant possessing a site maturation at a critical C-terminal residue., Biochemistry , 29(1), 173-8, 1990

Created on 2010-06-16 16:13:16, Last reviewed on 2015-01-08 16:23:59 (Show full history)

A/A	Date	Curator(s)	Comments
1	2010-06-16 16:13:16	The IthaGenes Curation Team	Created
2	2013-10-15 17:00:14	The IthaGenes Curation Team	Reviewed.
3	2014-04-15 12:26:12	The IthaGenes Curation Team	Reviewed. Added common name, allele and clinical phenotype, reference and ClinVar link.
4	2015-01-08 16:23:59	The IthaGenes Curation Team	Reviewed. Common name corrected.

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.