IthaID: 764

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Benign / Likely Benign
Common Name: CD 136 CTG>ATG [Leu>Met] HGVS Name: HBA2:c.409C>A
Hb Name: Hb Chicago Protein Info: α2 136(H19) Leu>Met
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GTTCCTGGCTTCTGTGAGCACCGTG [C/A] TGACCTCCAAATACCGTTAAGCTGG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVMTSKYR

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34443
Size: 1 bp
Located at: α2
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: African
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
190 Hb Chicago α2 D-10 Dual Kit Program 82.3 1.69 Heterozygous. Elutes as HbA. [PDF]
191 Hb Chicago α2 VARIANT β-thal Short Program 84 2.47 Heterozygous. Elutes as HbA. [PDF]
192 Hb Chicago α2 VARIANT II β-thal Short Program 85 2.5 Heterozygous. Elutes as HbA. [PDF]
193 Hb Chicago α2 VARIANT II Dual Kit Program 82.3 1.767 Heterozygous. Elutes as HbA. [PDF]
194 Hb Chicago α2 VARIANT II Dual Kit Program 82.3 1.767 Heterozygous. Elutes as HbA. [PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Bowman JE, Bloom R, Chen SS, Webber BB, Wilson JB, Kutlar F, Kutlar A, Huisman TH, HB Chicago or alpha (2)136 (H19) Leu----Met beta 2 and a -G gamma-G gamma-globin gene arrangement in a black family., Hemoglobin , 10(5), 495-505, 1986
  2. Gu LH, Wilson JB, Molchanova TP, McKie KM, McKie VC, Huisman TH, Three sickle cell anemia patients each with a different alpha chain variant. Diagnostic complications., Hemoglobin , 17(4), 295-301, 1993
  3. Molchanova TP, Pobedimskaya DD, Huisman TH, The differences in quantities of alpha 2- and alpha 1-globin gene variants in heterozygotes., Br. J. Haematol. , 88(2), 300-6, 1994
Created on 2010-06-16 16:13:16, Last reviewed on 2020-01-30 09:53:06 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.