IthaID: 720


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Benign / Likely Benign
Common Name: CD 116 GAG>AAG [Glu>Lys] HGVS Name: HBA1:c.349G>A
Hb Name: Hb O-Indonesia Protein Info: α1 116(GH4) Glu>Lys

Context nucleotide sequence:
GACCCTGGCCGCCCACCTCCCCGCC [A/C/G] AGTTCACCCCTGCGGTGCACGCCTC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAKFTPAVHASLDKFLASVSTVLTSKYR

Also known as: Hb Buginese-X, Hb Oliviere

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 38194
Size: 1 bp
Located at: α1
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Buginese, Chinese, Iranian, Italian, Makassars, South African, Indian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Molchanova TP, Pobedimskaya DD, Huisman TH, The differences in quantities of alpha 2- and alpha 1-globin gene variants in heterozygotes., Br. J. Haematol. , 88(2), 300-6, 1994
  2. Daud D, Harahap A, Setianingsih I, Nainggolan I, Tranggana S, Pakasi R, Marzuki S, The hemoglobin O mutation in Indonesia: distribution and phenotypic expression., J. Hum. Genet. , 46(9), 499-505, 2001
  3. Kumar R, Patel P, Gwal A, Bharti PK, Colah R, Rajasubramaniam S, Clinico-Hematological Presentation of Rare Hemoglobin Variant (HB-O Indonesia) in 3 Families., Indian J Hematol Blood Transfus, 35(3), 596-598, 2019
Created on 2010-06-16 16:13:16, Last reviewed on 2020-01-29 16:05:44 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.