IthaID: 668
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
---|---|---|---|
Common Name: | CD 92 CGG>CAG [Arg>Gln] | HGVS Name: | HBA1:c.278G>A |
Hb Name: | Hb J-Cape Town | Protein Info: | α1 92(FG4) Arg>Gln |
Context nucleotide sequence:
AGCGACCTGCACGCGCACAAGCTTC [G/A] GGTGGACCCGGTCAACTTCAAGGTG (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLQVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Also known as:
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | Increased Oxygen Affinity |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 37973 |
Size: | 1 bp |
Located at: | α1 |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Japanese, South African, Italian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Note:
The impact thresholds provided in this section are based on the analyses performed in Tamana et.al. For any given tool, the impact thresholds defined for the set of variants with the same effect on function as the variant examined, are preferred over those defined for the full dataset.
Publications / Origin
- Botha MC, Beale D, Isaacs WA, Lehmann H, Hemoglobin J Cape Town-alpha-2 92 arginine replaced by glutamine beta-2., Nature , 212(5064), 792-5, 1966
- Ogawa S, Shulman RG, Kynoch PA, Lehmann H, High resolution nuclear magnetic resonance studies of haemoglobin J Capetown., Nature , 225(5237), 1042-3, 1970
- Charache S, Jenkins T, Oxygen equilibrium of hemoglobin J Cape Town., J. Clin. Invest. , 50(7), 1554-5, 1971
- Nagel RL, Gibson QH, Jenkins T, Ligand binding in hemoglobin J Capetown., J. Mol. Biol. , 58(3), 643-50, 1971
- Botha MC, Stathopoulou R, Lehmann H, Rees JS, Plowman D, A Hb J Cape Town homozygote--association of Hb J Cape Town and alpha-thalassaemia., FEBS Lett. , 96(2), 331-4, 1978
- Molchanova TP, Pobedimskaya DD, Huisman TH, The differences in quantities of alpha 2- and alpha 1-globin gene variants in heterozygotes., Br. J. Haematol. , 88(2), 300-6, 1994
- Pagano L, Flagiello A, Tedesco R, Ammirabile M, Pollio F, Prossomariti L, Giambona A, Passarello C, Pucci P, Hb J-Cape Town [alpha92(FG4)Arg-->Gln (alpha1), CGG-->CAG] in Southern Italy found in a patient with erythrocytosis., Hemoglobin , 31(2), 113-20, 2007
Created on 2010-06-16 16:13:16,
Last reviewed on 2021-04-07 12:09:10 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:16 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2014-04-14 11:38:36 | The IthaGenes Curation Team | Reviewed. Added references, common name, allele phenotype and ClinVar link. |
4 | 2021-04-07 12:09:10 | The IthaGenes Curation Team | Reviewed. HGVS, protein name and Locus location corrected. Origin added. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2024-04-18 10:10:45