IthaID: 652


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 88 GCG>GTG [Ala>Val] HGVS Name: HBA1:c.266C>T | HBA2:c.266C>T
Hb Name: Hb Columbia Missouri Protein Info: α2 or α1 88(F9) Ala>Val

Context nucleotide sequence:
CTGTCCGCCCTGAGCGACCTGCACG [A/C/G/T] GCACAAGCTTCGGGTGGACCCGGTC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHVHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34158 or 37962
Size: 1 bp or 1 bp
Located at: α1 or α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Caucasian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Perry MC, Head C, Fairbanks VF, Jones RT, Taylor H, Proud V, Hemoglobin Columbia Missouri or alpha 2[88 (F9) Ala----Val]beta 2: a new high-oxygen-affinity hemoglobin that causes erythrocytosis., Mayo Clin. Proc. , 66(1), 5-10, 1991
Created on 2010-06-16 16:13:16, Last reviewed on 2014-04-14 09:44:07 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.