IthaID: 648

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 87 CAC>CGC [His>Arg] HGVS Name: HBA1:c.263A>G | HBA2:c.263A>G
Hb Name: Hb Iwata Protein Info: α2 or α1 87(F8) His>Arg
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GCGCTGTCCGCCCTGAGCGACCTGC [A/C/G] CGCGCACAAGCTTCGGGTGGACCCG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLRAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34155 or 37959
Size: 1 bp or 1 bp
Located at: α1 or α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese, Japanese
Molecular mechanism: Altered heme pocket
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Ohba Y, Miyaji T, Hattori Y, Fuyuno K, Matsuoka M, Unstable hemoglobins in Japan., Hemoglobin , 4(3), 307-12, 1980
  2. Liu GY, Zhang GX, Nie SY, Luo HY, Teng YQ, Liu SP, Song M, Son L, Chen SS, Jia PC, Liang CC, A case of hemoglobin Iwata [alpha 87(F8)His leads to Arg] in China., Hemoglobin , 7(3), 279-82, 1983
Created on 2010-06-16 16:13:16, Last reviewed on 2014-04-14 09:30:58 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.