IthaID: 624


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 78 AAC>GAC [Asn>Asp] HGVS Name: HBA1:c.235A>G | HBA2:c.235A>G
Hb Name: Hb J-Singa Protein Info: α2 or α1 78(EF7) Asn>Asp

Context nucleotide sequence:
CGTGGCGCACGTGGACGACATGCCC [A/G] ACGCGCTGTCCGCCCTGAGCGACCT (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPDALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

Comments: Found in a French-Acadian family clinically asymptomatic.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34127 or 37931
Size: 1 bp or 1 bp
Located at: α1 or α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: French-Acadian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Wong SC, Ali MA, Pond JR, Rubin SM, Johnson SE, Wilson JB, Huisman TH, Hb J-Singa (alpha-78 Asn leads to Asp), a newly discovered hemoglobin variant with the same amino acid substitution as one of the two present in Hb J-Singapore (alpha-78 Asn leads to, alpha-79 Ala leads to Gly)., Biochim. Biophys. Acta , 784(2), 187-8, 1984
Created on 2010-06-16 16:13:16, Last reviewed on 2021-03-05 12:55:33 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.