IthaID: 564

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 56 AAG>GAG [Lys>Glu] HGVS Name: HBA2:c.169A>G
Hb Name: Hb Shaare Zedek Protein Info: α2 56(E5) Lys>Glu
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CCTGAGCCACGGCTCTGCCCAGGTT [A/G] AGGGCCACGGCAAGAAGGTGGCCGA (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVEGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: Hb Shaare Zedek is a rare structural α-Hb chain variant first identified in a Jewish family of Persian descent and later in a Chinese patient. In a recent report, Thai patients with Hb Shaare Zedek in both the heterozygote form and in combination with β0-thalassemia, are described.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34061
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Jewish, Chinese, Thai
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Abramov A, Lehmann H, Robb L, Hb Shaare Zedek (alpha 56 E5 Lys leads to Glu)., FEBS Lett. , 113(2), 235-7, 1980
  2. Eliakim R, Rachmilewitz EA, Hemoglobinopathies in Israel., Hemoglobin, 7(5), 479-85, 1983
  3. Li Y, Tian M, Qin T, Wan L, Capillary Electrophoresis Resolves Inconclusive HPLC Analysis for Hemoglobin Variants: a Study of Two Cases., Clin Lab, 64(7), 1305-1309, 2018
  4. Satthakarn S, Srisuwan W, Kunyanone N, Panyasai S, Novel Insights into Hb Shaare Zedek Associated with β-Thalassemia: Molecular Characteristics, Genetic Origin and Diagnostic Approaches., Int J Mol Sci, 25(16), , 2024
Created on 2010-06-16 16:13:15, Last reviewed on 2024-09-09 14:23:51 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.