IthaID: 563

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 55 GTT>GCT [Val>Ala] HGVS Name: HBA2:c.167T>C
Hb Name: Hb Gerland Protein Info: α2 55(E4) Val>Ala
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GACCTGAGCCACGGCTCTGCCCAGG [C/T] TAAGGGCCACGGCAAGAAGGTGGCC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQAKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34059
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: French
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
120Hb Gerlandα2D-10Dual Kit Program87.41.68Heterozygous. Elutes with HbA. Clinically asymptomatic neutral alpha chain variant. [PDF]
121Hb Gerlandα2VARIANTβ-thal Short Program85.72.46Heterozygous. Elutes with HbA. Clinically asymptomatic neutral alpha chain variant.[PDF]
122Hb Gerlandα2VARIANT IIβ-thal Short Program87.62.47
123Hb Gerlandα2VARIANT IIDual Kit Program8.12.609Heterozygous. Elutes with HbA. Clinically asymptomatic neutral alpha chain variant.[PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Lacan P, Aubry M, Couprie N, Francina A, Hb Gerland [alpha55(E4)Val-->Ala (alpha2)]: a new neutral alpha chain variant involving the alpha2 gene., Hemoglobin , 25(4), 417-20, 2001
Created on 2010-06-16 16:13:15, Last reviewed on 2014-03-28 14:30:06 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.