IthaID: 551
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 50 CAC>CGC [His>Arg] | HGVS Name: | HBA1:c.152A>G | HBA2:c.152A>G |
Hb Name: | Hb Aichi | Protein Info: | α2 or α1 50(CE8) His>Arg |
Context nucleotide sequence:
TACTTCCCGCACTTCGACCTGAGCC [A/G] CGGCTCTGCCCAGGTTAAGGGCCAC (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSRGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Also known as:
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-chain variant |
Allele Phenotype: | N/A |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 34044 or 37848 |
Size: | 1 bp or 1 bp |
Located at: | α1 or α2 |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Japanese, French Caucasian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | No |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
---|---|---|---|---|---|---|---|---|---|
599 | Hb Aichi | α1 or α2 | D-10 | Dual Kit Program | 21.9 | 4.05 | Heterozygous. Elutes as HbS. | [PDF] | |
600 | Hb Aichi | α1 or α2 | VARIANT | β-thal Short Program | 19.7 | 4.17 | Heterozygous. Elutes as HbS. | [PDF] | |
601 | Hb Aichi | α1 or α2 | VARIANT II | β-thal Short Program | 21.1 | 4.33 | Heterozygous. Elutes as HbS. | [PDF] | |
602 | Hb Aichi | α1 or α2 | VARIANT II | Dual Kit Program | 22.5 | 3.465 | Heterozygous. Elutes as HbS. | [PDF] |
In silico pathogenicity prediction
Note:
The impact thresholds provided in this section are based on the analyses performed in Tamana et.al. For any given tool, the impact thresholds defined for the set of variants with the same effect on function as the variant examined, are preferred over those defined for the full dataset.
Publications / Origin
- Harano T, Harano K, Shibata S, Ueda S, Mori H, Seki M, Hemoglobin Aichi [alpha 50(CE8) His----Arg]: a new slightly unstable hemoglobin variant discovered in Japan., FEBS Lett. , 169(2), 297-9, 1984
- Baudin V, Baklouti F, Wajcman H, Delaunay J, Hemoglobin Aichi [alpha 50(CE8)His----Arg] in a French Caucasian patient., Hemoglobin, 11(2), 145-9, 1987
Created on 2010-06-16 16:13:15,
Last reviewed on 2022-05-11 11:00:15 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:15 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2014-03-27 13:33:17 | The IthaGenes Curation Team | Reviewed. |
4 | 2015-12-14 11:32:49 | The IthaGenes Curation Team | Reviewed. |
5 | 2022-05-11 11:00:15 | The IthaGenes Curation Team | Reviewed. Origin and reference added. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2024-11-20 13:24:07